PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A02272.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 241aa    MW: 27512.2 Da    PI: 9.2504
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A02272.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.14.9e-281059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    ri+n++ rqvtfskRrngi+KKA+EL +LCdaev ++ifsstg+lyeyss
  Pahal.A02272.1 10 RIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLMIFSSTGRLYEYSS 59
                    8***********************************************96 PP

2K-box96.54.2e-3276171499
           K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                     ++ +++ +++ + +q+e+a L+++++nLq+++R+l+GedL+ L++keLq+Le+qLe+sl+ +RskK++ll+++i+el +k    ++en++L +k+
  Pahal.A02272.1  76 QQVVANPNSELKFWQREAASLRQQLHNLQENHRQLMGEDLSGLNVKELQSLENQLETSLRGVRSKKDHLLIDEIHELNRKASLFHQENMDLYNKI 170
                     5566688999**********************************************************************************998 PP

           K-box  99 e 99 
                     +
  Pahal.A02272.1 171 N 171
                     6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.651161IPR002100Transcription factor, MADS-box
CDDcd002655.68E-45277No hitNo description
SuperFamilySSF554555.89E-33291IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.3E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-273859IPR002100Transcription factor, MADS-box
PfamPF014862.8E-2983170IPR002487Transcription factor, K-box
PROSITE profilePS5129716.05286176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010440Biological Processstomatal lineage progression
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGIFK KAKELAILCD AEVGLMIFSS TGRLYEYSST  60
SMKSVIDRYG KAKEEQQVVA NPNSELKFWQ REAASLRQQL HNLQENHRQL MGEDLSGLNV  120
KELQSLENQL ETSLRGVRSK KDHLLIDEIH ELNRKASLFH QENMDLYNKI NQIRQENAEL  180
YKKIYQTEGP SEVNRESPTP YNFALVENTD VPVQLGLSTL PQQNSIEISN APKLGLQLNP  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-19183183Myocyte-specific enhancer factor 2B
1tqe_R1e-19183183Myocyte-specific enhancer factor 2B
1tqe_Q1e-19183183Myocyte-specific enhancer factor 2B
1tqe_P1e-19183183Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00410DAPTransfer from AT3G57230Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1121490.0AF112149.1 Zea mays MADS box protein 2 (mads2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952891.11e-172PREDICTED: MADS-box transcription factor 27
SwissprotQ6EP491e-162MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLQ9FVN11e-160Q9FVN1_MAIZE; MADS box protein 2
STRINGLOC_Os02g36924.11e-159(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61435130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.13e-97AGAMOUS-like 16